HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GRJ8

Names and origin
Entry : E3GRJ8 (unreviewed)
Entry name : E3GRJ8_HAEI2
Protein names : 50S ribosomal protein L28
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : rpL28
ORF names : rpmB
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ribosome; structural constituent of ribosome; translation
GO identifier : GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein L28P family
Protein sequence
Length : 86 residues
>E3GRJ8|E3GRJ8_HAEI2 Haemophilus influenzae R2846
MSRVCQVTGKRPAVGNNRSHAMNATRRRFLPNLHTHRFWVESENRFVTLRLTAKGMRIID
KKGIDAVLAEIRARGEKI