HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GRJ3

Names and origin
Entry : E3GRJ3 (unreviewed)
Entry name : E3GRJ3_HAEI2
Protein names : UPF0270 protein R2846_1353
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : yheU
ORF names : R2846_1353
History
Date of creation : 2011-01-11
Date of modification : 2013-05-29
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to UPF0270 family
Protein sequence
Length : 91 residues
>E3GRJ3|E3GRJ3_HAEI2 Haemophilus influenzae R2846
MIIPWQELEAETLDNIVESVILREGTDYGIEELSLNQKKQLLLTQIRNGIALIVWSELHE
SIDIKNKTEFLKQECKEQECQMN