HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GRH0

Names and origin
Entry : E3GRH0 (unreviewed)
Entry name : E3GRH0_HAEI2
Protein names : Bifunctional protein PyrR
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : pyrR
ORF names : R2846_0120
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : nucleoside metabolic process; regulation of transcription, DNA-dependent; transcription, DNA-dependent; uracil phosphoribosyltransferase activity
GO identifier : GO:0009116; GO:0006355; GO:0006351; GO:0004845
Keywords
Ligand & Biological process : Complete proteome; Glycosyltransferase; Transcription; Transcription regulation; Transferase
General annotation
Sequence similarities : Belongs to Purine/pyrimidine phosphoribosyltransferase family, PyrR subfamily
Protein sequence
Length : 191 residues
>E3GRH0|E3GRH0_HAEI2 Haemophilus influenzae R2846
MEKIIIDHDRFLRTISRISHEIIEKHQTLDDLVIVGIKRRGAEIAELLQRRVEELSGINL
PSMELDITFYRDDLTLVDQEDKMPVYSGSSQYLNIQDKTVILVDDVLFTGRTIRAAMDAL
TDFGRAAKIELVIFVDRGHRELPIRADYVGKNVPTSRDELVQVRTEKQDGCYEVAILGK