HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GRE8

Names and origin
Entry : E3GRE8 (unreviewed)
Entry name : E3GRE8_HAEI2
Protein names : ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : atpH
ORF names : R2846_0098
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : plasma membrane; plasma membrane ATP synthesis coupled proton transport; proton-transporting ATP synthase activity, rotational mechanism; proton-transporting ATP synthase complex, catalytic core F(1)
GO identifier : GO:0005886; GO:0042777; GO:0046933; GO:0045261
Keywords
Ligand & Biological process : ATP synthesis; CF(1); Cell inner membrane; Cell membrane; Complete proteome; Hydrogen ion transport; Hydrolase; Ion transport; Membrane; Transport
General annotation
Sequence similarities : Belongs to ATPase delta chain family
Subcellular location : Cell inner membrane; Peripheral membrane protein.
Protein sequence
Length : 189 residues
>E3GRE8|E3GRE8_HAEI2 Haemophilus influenzae R2846
MSELTTIARPYAKAAFDFAIEQSAVEKWTEMLGFAAAVAEDETVKAYLSSSLSAQKLADT
VISICGEQLDQYGQNLIRLMAENKRLSAIPAVFEEFKHHVEEHQAIAEVEVTSAQPLNAT
QIEKIAAAMEKRLARKVKLNCNVDNALIAGVIVRTEDFVIDGSSRGQLTRLANELQL