HIGDB: Haemophilus influenzae Genome Database

Protein search results for - E3GRD2

Names and origin

Entry	:	E3GRD2 (unreviewed)
Entry name	:	E3GRD2_HAEI2
Protein names	:	D-ribose pyranase (EC 5.5.1.n1)
Organism	:	Haemophilus influenzae R2846
Organism ID	:	262727
Gene names	:	rbsD
ORF names	:	R2846_0082
EC number	:	5.5.1.n1

History

Date of creation	:	2011-01-11
Date of modification	:	2013-10-16
Date of sequence modification	:	2011-01-11

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	D-ribose catabolic process; cytoplasm; intramolecular lyase activity; monosaccharide binding
GO identifier	:	GO:0019303; GO:0005737; GO:0016872; GO:0048029

Keywords

Ligand & Biological process

Carbohydrate metabolism; Complete proteome; Cytoplasm; Isomerase

General annotation

Pathway	:	Carbohydrate metabolism; D-ribose degradation; D-ribose 5-phosphate from beta-D-ribopyranose: step 1/2.
Sequence similarities	:	Belongs to RbsD / FucU family, RbsD subfamily
Subcellular location	:	Cytoplasm.

Protein sequence

Length

151 residues

>E3GRD2|E3GRD2_HAEI2 Haemophilus influenzae R2846
MKKTMLLNAQLSRCIASVGHTESLTICDAGLPIPLSVERIDLALTAGVPSFLQTLNVVTN
EMYVERVVIAEEIKEKNPEILTALLTQLQQLESHQGNQIQVEFVSHETFKKFTLESKAIV
RTGECSPYANVILYSGVPF