HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GRB9

Names and origin
Entry : E3GRB9 (unreviewed)
Entry name : E3GRB9_HAEI2
Protein names : 50S ribosomal protein L1
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : rpL1
ORF names : rplA
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : large ribosomal subunit; rRNA binding; regulation of translation; structural constituent of ribosome; tRNA binding; translation
GO identifier : GO:0015934; GO:0019843; GO:0006417; GO:0003735; GO:0000049; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Repressor; Ribonucleoprotein; Ribosomal protein; Translation regulation; rRNA-binding; tRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L1P family
Protein sequence
Length : 245 residues
>E3GRB9|E3GRB9_HAEI2 Haemophilus influenzae R2846
MAKLTKKMKAIKAGVDSTKAYEINEAIAVLKQFATAKFVESVDVAVNLGIDPRKSDQNVR
GATVLPHGTGREVRVAVFTQGANADAAKEAGADLVGMEDLAEQIKKGEMNFDVVIASPDA
MRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVKNAKSGQIRYRNDKNGIIHTTIGKANF
SEVQLKENLQALLVALNKAKPTTAKGIFIKKVSISTTMGAGVAVDQASL