HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GRB8

Names and origin
Entry : E3GRB8 (unreviewed)
Entry name : E3GRB8_HAEI2
Protein names : 50S ribosomal protein L11
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : rpL11
ORF names : rplK
History
Date of creation : 2011-01-11
Date of modification : 2013-11-13
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : LSU rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier : GO:0070180; GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Methylation; RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L11P family
Protein sequence
Length : 154 residues
>E3GRB8|E3GRB8_HAEI2 Haemophilus influenzae R2846
MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNARTESLEKGLPIPVVIT
VYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKVTLDQVRQIAETKAADMTGA
TIETKMKSIAGTARSMGLVVEE