HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GRA8

Names and origin
Entry : E3GRA8 (unreviewed)
Entry name : E3GRA8_HAEI2
Protein names : Putative 4Fe-4S ferredoxin-type protein
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : fdx-2
ORF names : R2846_0058
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : iron-sulfur cluster binding
GO identifier : GO:0051536
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 94 residues
>E3GRA8|E3GRA8_HAEI2 Haemophilus influenzae R2846
MALFITSKCTNCDMCLPECPNEAISIGDEIYVIDPILCTECVGHYDTPTCQKVCPITNCI
KPDPEHQETEEQLWERFVMIHHSDKL