HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GR94

Names and origin
Entry : E3GR94 (unreviewed)
Entry name : E3GR94_HAEI2
Protein names : Urease subunit gamma (EC 3.5.1.5) (Urea amidohydrolase subunit gamma)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : ureA
ORF names : R2846_0044
EC number : 3.5.1.5
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; nickel cation binding; urea catabolic process; urease activity
GO identifier : GO:0005737; GO:0016151; GO:0043419; GO:0009039
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Hydrolase
General annotation
Pathway : Nitrogen metabolism; urea degradation; CO(2) and NH(3) from urea (urease route): step 1/1.
Sequence similarities : Belongs to Urease gamma subunit family
Subcellular location : Cytoplasm.
Protein sequence
Length : 108 residues
>E3GR94|E3GR94_HAEI2 Haemophilus influenzae R2846
MHLTSREQEKLMLFLAGELAAKRKARGVKLNYPETIAYIASHLQEAARDGMSVAEVMQYG
ATLLTVDDVMEGVAEMVHEVQIEATFPDGTKLVTVHNPIR