HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GR93

Names and origin
Entry : E3GR93 (unreviewed)
Entry name : E3GR93_HAEI2
Protein names : 10 kDa chaperonin (GroES protein) (Protein Cpn10)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : groES
ORF names : groS
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; cytoplasm; protein folding
GO identifier : GO:0005524; GO:0005737; GO:0006457
Keywords
Ligand & Biological process : Chaperone; Complete proteome; Cytoplasm
General annotation
Sequence similarities : Belongs to GroES chaperonin family
Subcellular location : Cytoplasm.
Protein sequence
Length : 104 residues
>E3GR93|E3GR93_HAEI2 Haemophilus influenzae R2846
MNIRPLHDRVIIKREEVETRSAGGIVLTGSAATKSTRAKVLAVGKGRILENGTVQPLDVK
VGDIVIFNDGYGVKSEKIDGEEVLIISENDILAIVE