HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XBQ2

Names and origin
Entry : E1XBQ2 (unreviewed)
Entry name : E1XBQ2_HAEI1
Protein names : Transcriptional repressor NrdR
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : nrdR
ORF names : HIB_10810
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; DNA binding; negative regulation of transcription, DNA-dependent; transcription, DNA-dependent; zinc ion binding
GO identifier : GO:0005524; GO:0003677; GO:0045892; GO:0006351; GO:0008270
Keywords
Ligand & Biological process : ATP-binding; Complete proteome; DNA-binding; Metal-binding; Nucleotide-binding; Repressor; Transcription; Transcription regulation; Zinc; Zinc-finger
General annotation
Domains : ATP-cone domain (1)
Sequence similarities : Belongs to NrdR family
Protein sequence
Length : 161 residues
>E1XBQ2|E1XBQ2_HAEI1 Haemophilus influenzae 10810
MHCPFCDTEETKVIDSRLVSDGYQVRRRRECGHCHERFTTFEMAELIIPKIIKTDGTREP
FNEDKLRSGIQHALEKRPVSADDVEKAINHIILQLRATGEREVPSKLVGKLAMNELKKLD
KVAYIRFASVYLSFDDIDQFTIEIEKLKD