HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XBJ5

Names and origin
Entry : E1XBJ5 (unreviewed)
Entry name : E1XBJ5_HAEI1
Protein names : DNA gyrase inhibitor YacG
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : yacG
ORF names : HIB_10240
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA topoisomerase (ATP-hydrolyzing) inhibitor activity; negative regulation of DNA topoisomerase (ATP-hydrolyzing) activity; regulation of transcription, DNA-dependent; zinc ion binding
GO identifier : GO:0008657; GO:2000372; GO:0006355; GO:0008270
Keywords
Ligand & Biological process : Complete proteome; Metal-binding; Zinc
General annotation
Sequence similarities : Belongs to DNA gyrase inhibitor YacG family
Protein sequence
Length : 76 residues
>E1XBJ5|E1XBJ5_HAEI1 Haemophilus influenzae 10810
MPDEMIEVPCPICQKSVPWINESTFRPFCSKRCQLIDLGEWAAEEKAIPSDTADFAMDSN
VSDEWSIK