HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XBI0

Names and origin
Entry : E1XBI0 (unreviewed)
Entry name : E1XBI0_HAEI1
Protein names : Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : ndk
ORF names : HIB_10090
EC number : 2.7.4.6
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; CTP biosynthetic process; GTP biosynthetic process; UTP biosynthetic process; cytoplasm; endonuclease activity; metal ion binding; nucleoside diphosphate kinase activity
GO identifier : GO:0005524; GO:0006241; GO:0006183; GO:0006228; GO:0005737; GO:0004519; GO:0046872; GO:0004550
Keywords
Ligand & Biological process : ATP-binding; Complete proteome; Cytoplasm; Endonuclease; Hydrolase; Kinase; Magnesium; Metal-binding; Nuclease; Nucleotide metabolism; Nucleotide-binding; Phosphoprotein; Transferase
General annotation
Sequence similarities : Belongs to NDK family
Subcellular location : Cytoplasm.
Protein sequence
Length : 152 residues
>E1XBI0|E1XBI0_HAEI1 Haemophilus influenzae 10810
MTERTFSIIKPDAVKRNLIGAILTRFEQNGFKIIASKMVRLTREQAEGFYAEHQGKEFFA
PLVEYMMSSPIVVSVLEKENAVKDYRTLIGTTNPETAEEGTIRKDFALSQRENSVHGSDS
IENANREIAYFFTDCEIFER