HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XBG1

Names and origin
Entry : E1XBG1 (unreviewed)
Entry name : E1XBG1_HAEI1
Protein names : Protein that localizes to the cytokinetic ring
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_09900
History
Date of creation : 2010-11-30
Date of modification : 2013-11-13
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : barrier septum assembly; cytoplasm
GO identifier : GO:0000917; GO:0005737
Keywords
Ligand & Biological process : Cell cycle; Cell division; Complete proteome; Cytoplasm; Septation
General annotation
Subcellular location : Cytoplasm.
Protein sequence
Length : 108 residues
>E1XBG1|E1XBG1_HAEI1 Haemophilus influenzae 10810
MSLKLVEILVLGQVLRLNVPIEQEELLRQAARNLDILVSEMKEKTGLIQLDRVLSIVALN
LSFELSQEKNKTAKIEEVLRTGIQQLDHSLENIRVTKEPS