HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XBE3

Names and origin
Entry : E1XBE3 (unreviewed)
Entry name : E1XBE3_HAEI1
Protein names : Outer membrane protein assembly factor BamE
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : bamE
ORF names : HIB_09720
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : Gram-negative-bacterium-type cell outer membrane assembly; cell outer membrane; plasma membrane; protein insertion into membrane
GO identifier : GO:0043165; GO:0009279; GO:0005886; GO:0051205
Keywords
Ligand & Biological process : Cell membrane; Cell outer membrane; Complete proteome; Lipoprotein; Membrane; Palmitate; Signal
General annotation
Sequence similarities : Belongs to BamE family
Subcellular location : Cell outer membrane; Lipid-anchor.
Protein sequence
Length : 149 residues
>E1XBE3|E1XBE3_HAEI1 Haemophilus influenzae 10810
MQVKTLLGATFLALSLASCSTVEKVVYRIDVPQGNYLEATTVAQVKEGMTARQVQYLLGT
PVLVDPYNSQTWYYVFLQQRAYETPVQHTLTVKFDPHGIVTETHLDKPLPQVSQQGENNT
IIETGEKPKSSWWKFWK