HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XBD7

Names and origin
Entry : E1XBD7 (unreviewed)
Entry name : E1XBD7_HAEI1
Protein names : Fumarate reductase subunit C
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : frdC
ORF names : HIB_09660
History
Date of creation : 2010-11-30
Date of modification : 2013-05-29
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; plasma membrane
GO identifier : GO:0016021; GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to FrdC family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Protein sequence
Length : 148 residues
>E1XBD7|E1XBD7_HAEI1 Haemophilus influenzae 10810
MSVTVSKRKKYVRPMTATWWQKLDFYKAYMLREATSVFAVWFCIVLLYGVLCLASNPMPG
LGILSFIEFLRNPIVVFLNIITLIATLYHTVTYFLMTPKVMNIIVKNERLPHTVVRNALW
AVTALVSVIALALVYI