HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XBD6

Names and origin
Entry : E1XBD6 (unreviewed)
Entry name : E1XBD6_HAEI1
Protein names : Fumarate reductase subunit D
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : frdD
ORF names : HIB_09650
History
Date of creation : 2010-11-30
Date of modification : 2013-05-29
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : fumarate metabolic process; integral to membrane; plasma membrane
GO identifier : GO:0006106; GO:0016021; GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to FrdD family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Protein sequence
Length : 122 residues
>E1XBD6|E1XBD6_HAEI1 Haemophilus influenzae 10810
MVDQNPKRSGEPPVWLMFGAGGTVSAIFLPVVILIIGLLLPFGLVDAHNLITFAYSWIGK
LVILVLTIFPMWCGLHRIHHGMHDLKVHVPAGGFIFYGLATIYTVWVLFAVINL