HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XBD0

Names and origin
Entry : E1XBD0 (unreviewed)
Entry name : E1XBD0_HAEI1
Protein names : Probable intracellular septation protein A
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_09590
History
Date of creation : 2010-11-30
Date of modification : 2013-12-11
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : barrier septum assembly; integral to membrane; plasma membrane
GO identifier : GO:0000917; GO:0016021; GO:0005886
Keywords
Ligand & Biological process : Cell cycle; Cell division; Cell inner membrane; Cell membrane; Complete proteome; Membrane; Septation; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to YciB family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Protein sequence
Length : 201 residues
>E1XBD0|E1XBD0_HAEI1 Haemophilus influenzae 10810
MKQLLDFIPLILFFITYKLGGVREAAIVLVVATILQIVILKWKYGIVEKQQKIMASAVVF
FGLLTAYFNEIRYLQWKVTIINGLFAIVLLVAQFQFKTPLIKKLLGKELQLPEKAWNTLN
LGWAIFFIICMLVNIYISHNMSEEAWVDFKSFGIIGMTVIATIISGVYIYRYLPKDGSNS
KDGEK