HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XBB7

Names and origin
Entry : E1XBB7 (unreviewed)
Entry name : E1XBB7_HAEI1
Protein names : Carbon storage regulator homolog
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : csrA
ORF names : HIB_09460
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : RNA binding; mRNA catabolic process; regulation of carbohydrate metabolic process
GO identifier : GO:0003723; GO:0006402; GO:0006109
Keywords
Ligand & Biological process : Complete proteome; RNA-binding
General annotation
Sequence similarities : Belongs to CsrA family
Protein sequence
Length : 71 residues
>E1XBB7|E1XBB7_HAEI1 Haemophilus influenzae 10810
MLILTRKVGESVLIEDDISITVLSVRGNQVKLGVEAPKEVSVHREEIYQRIKQTKDEPYL
GSS