HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XBA7

Names and origin
Entry : E1XBA7 (unreviewed)
Entry name : E1XBA7_HAEI1
Protein names : 50S ribosomal protein L17
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : rplQ
ORF names : HIB_09360
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ribosome; structural constituent of ribosome; translation
GO identifier : GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein L17P family
Protein sequence
Length : 140 residues
>E1XBA7|E1XBA7_HAEI1 Haemophilus influenzae 10810
MRHRKSGRQLNRNSSHRQAMFRNLASALVSHEIIKTTLPKAKELRRVVEPLITLAKVDSV
ANRRLAFARTRNVETVAKLFNELGPRFAQRAGGYTRILKCGFRAGDNAPMAYIELVDRPE
VAEATTEE