HIGDB: Haemophilus influenzae Genome Database

Protein search results for - E1XBA3

Names and origin

Entry	:	E1XBA3 (unreviewed)
Entry name	:	E1XBA3_HAEI1
Protein names	:	30S ribosomal protein S13
Organism	:	Haemophilus influenzae 10810
Organism ID	:	862964
Gene names	:	rpsM
ORF names	:	HIB_09320

History

Date of creation	:	2010-11-30
Date of modification	:	2013-10-16
Date of sequence modification	:	2010-11-30

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	rRNA binding; ribosome; structural constituent of ribosome; tRNA binding; translation
GO identifier	:	GO:0019843; GO:0005840; GO:0003735; GO:0000049; GO:0006412

Keywords

Ligand & Biological process

Complete proteome; RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding; tRNA-binding

General annotation

Sequence similarities

Belongs to Ribosomal protein S13P family

Protein sequence

Length

126 residues

>E1XBA3|E1XBA3_HAEI1 Haemophilus influenzae 10810
MARIAGINIPDHKHAVIALTAIYGIGKTRSQAICAAAGIAEDVKIRELSEEQIDKLRDEV
GKFTVEGDLRREVTLNIKRLLDLGCYRGLRHRRSLPVRGQRTKTNARTRKGPRKPIKK