HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XB99

Names and origin
Entry : E1XB99 (unreviewed)
Entry name : E1XB99_HAEI1
Protein names : 50S ribosomal protein L30
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : rpmD
ORF names : HIB_09280
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : large ribosomal subunit; structural constituent of ribosome; translation
GO identifier : GO:0015934; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein L30P family
Protein sequence
Length : 63 residues
>E1XB99|E1XB99_HAEI1 Haemophilus influenzae 10810
MAKTIKVTQVRSSIARLPKHKATLRGLGLRHMHHTVELIDTPAVRGMINQVSYMVKVEE