HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XB91

Names and origin
Entry : E1XB91 (unreviewed)
Entry name : E1XB91_HAEI1
Protein names : 50S ribosomal protein L14
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : rplN
ORF names : HIB_09200
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : large ribosomal subunit; rRNA binding; structural constituent of ribosome; translation
GO identifier : GO:0015934; GO:0019843; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L14P family
Protein sequence
Length : 135 residues
>E1XB91|E1XB91_HAEI1 Haemophilus influenzae 10810
MIQEQTMLDVADNSGARSVMCIKVLGGSHRRYAAIGDIIKITVKEAIPRGKVKKGDVLKA
VVVRTKKGVRRPDGSVIRFDGNACVILNNNTEQPIGTRIFGPVTRELRSEKFMKIISLAP
EVL