HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XB62

Names and origin
Entry : E1XB62 (unreviewed)
Entry name : E1XB62_HAEI1
Protein names : Probable Fe(2+)-trafficking protein
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_08910
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : iron ion binding
GO identifier : GO:0005506
Keywords
Ligand & Biological process : Complete proteome; Iron
General annotation
Sequence similarities : Belongs to Fe(2+)-trafficking protein family
Protein sequence
Length : 98 residues
>E1XB62|E1XB62_HAEI1 Haemophilus influenzae 10810
MARTVFCEYLKKEAEGLDFQLYPGELGKRIFDSVSKQAWGEWIKKQTMLVNEKKLNMMNA
EHRKLLEQEMVNFLFEGKDVHIEGYVPPSN