HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XB54

Names and origin
Entry : E1XB54 (unreviewed)
Entry name : E1XB54_HAEI1
Protein names : Probable thiol peroxidase (EC 1.11.1.-)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : tpx
ORF names : HIB_08830
EC number : 1.11.1.-
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell redox homeostasis; thioredoxin peroxidase activity
GO identifier : GO:0045454; GO:0008379
Keywords
Ligand & Biological process : Antioxidant; Complete proteome; Oxidoreductase; Peroxidase
General annotation
Domains : Thioredoxin domain (1)
Sequence similarities : Belongs to AhpC/TSA family, Tpx subfamily
Protein sequence
Length : 177 residues
>E1XB54|E1XB54_HAEI1 Haemophilus influenzae 10810
MTVTLAGNPIEVGGHFPQVGEIVENFILVGNDLADVALNDFAGKRKVLNIFPSIDTGVCA
TSVHKFNQQAAKLSNTVVLCISADLPFAQARFCGAEGIENAKTVSTFRNHALHSQLGVDI
QTGPLAGLTSRAVIVLDEQNNVLHSQLVEEIKEEPNYEAALAVLA