HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XB46

Names and origin
Entry : E1XB46 (unreviewed)
Entry name : E1XB46_HAEI1
Protein names : Protein-export protein SecB
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : secB
ORF names : HIB_08750
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; protein folding; protein tetramerization; protein transport
GO identifier : GO:0005737; GO:0006457; GO:0051262; GO:0015031
Keywords
Ligand & Biological process : Chaperone; Complete proteome; Cytoplasm; Protein transport; Translocation; Transport
General annotation
Sequence similarities : Belongs to SecB family
Subcellular location : Cytoplasm.
Protein sequence
Length : 181 residues
>E1XB46|E1XB46_HAEI1 Haemophilus influenzae 10810
MSEQKQDVAATEEQQPVLQIQRIYVKDVSFEAPNLPHIFQQEWKPKLGFDLSTETTQVGD
DLYEVVLNISVETTLEDSGDVAFICEVKQAGVFTISGLEDVQMAHCLTSQCPNMLFPYAR
ELVSNLVNRGTFPALNLSPVNFDALFVEYMNRQQAENAEEKSEEEQTKH