HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XB31

Names and origin
Entry : E1XB31 (unreviewed)
Entry name : E1XB31_HAEI1
Protein names : Protein CyaY
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : cyaY
ORF names : HIB_08600
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ferric iron binding; iron-sulfur cluster assembly
GO identifier : GO:0008199; GO:0016226
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to Frataxin family
Protein sequence
Length : 109 residues
>E1XB31|E1XB31_HAEI1 Haemophilus influenzae 10810
MNIAEFHQNIEQVWQKIEEELENQGADVDCETQGSVFTITFDNRTQIVINKQEPLLELWI
ASKLGGFHFAFKNGDWVSNDGQRFWDCFVEACAAHGENVQF