HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XB30

Names and origin
Entry : E1XB30 (unreviewed)
Entry name : E1XB30_HAEI1
Protein names : Uncharacterized protein
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_08590
History
Date of creation : 2010-11-30
Date of modification : 2013-12-11
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 42 residues
>E1XB30|E1XB30_HAEI1 Haemophilus influenzae 10810
MKKLLSILVLSAICIVTTGCGVKGSLYFPEKDQAQQTQ