HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XB23

Names and origin
Entry : E1XB23 (unreviewed)
Entry name : E1XB23_HAEI1
Protein names : Sulfurtransferase TusA homolog (EC 2.8.1.-)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : tusA
ORF names : HIB_08520
EC number : 2.8.1.-
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; sulfurtransferase activity
GO identifier : GO:0005737; GO:0016783
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Transferase
General annotation
Sequence similarities : Belongs to UPF0033 family, TusA subfamily
Subcellular location : Cytoplasm.
Protein sequence
Length : 87 residues
>E1XB23|E1XB23_HAEI1 Haemophilus influenzae 10810
MSEISVTQTLNTLGLRCPEPVMLVRKNIRHLNDGEILLIIADDPATTRDIPSFCQFMDHT
LLQSEVEKPPFKYWVKRGK