HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XB22

Names and origin
Entry : E1XB22 (unreviewed)
Entry name : E1XB22_HAEI1
Protein names : Protease HtpX (EC 3.4.24.-) (Heat shock protein HtpX)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : htpX
ORF names : HIB_08510
EC number : 3.4.24.-
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; metalloendopeptidase activity; plasma membrane; proteolysis; response to stress; zinc ion binding
GO identifier : GO:0016021; GO:0004222; GO:0005886; GO:0006508; GO:0006950; GO:0008270
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Hydrolase; Membrane; Metal-binding; Metalloprotease; Protease; Stress response; Transmembrane; Transmembrane helix; Zinc
General annotation
Sequence similarities : Belongs to Peptidase M48B family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Protein sequence
Length : 303 residues
>E1XB22|E1XB22_HAEI1 Haemophilus influenzae 10810
MMRILLFLATNMAVMLVLGIILNVTGIAGNSTGGILIMALLFGFAGSLISLFLSKTMALR
SVDGEVITQPRNQTERWLIDTVSRQAQKAGIPMPDVAIYHSPDVNAFATGATKSNSLVAV
STGLLNNMTEAEAEAVLAHEISHISNGDMVTMALLQGVLNTFVIFLSRVIATAVASSRNN
NGEETRSSGIYFLVSMVLEMLFGVLASIIAMWFSRYREFRADAGSASLVGKEKMIMALQR
LQQLHEPQNLEGSLNAFMINGKRSELFMSHPPLEKRIEALRNL