HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XAZ3

Names and origin
Entry : E1XAZ3 (unreviewed)
Entry name : E1XAZ3_HAEI1
Protein names : Genome
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_08220
History
Date of creation : 2010-11-30
Date of modification : 2013-12-11
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : lipid metabolic process; phosphoric diester hydrolase activity
GO identifier : GO:0006629; GO:0008081
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 49 residues
>E1XAZ3|E1XAZ3_HAEI1 Haemophilus influenzae 10810
MRKDALPAFFTDVNQMYDTLLNKSGVTGVFTDFPDTCVEFLKGIK