HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XAX5

Names and origin
Entry : E1XAX5 (unreviewed)
Entry name : E1XAX5_HAEI1
Protein names : Xanthine phosphoribosyltransferase (EC 2.4.2.22) (Xanthine-guanine phosphoribosyltransferase)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : gpt
ORF names : HIB_08040
EC number : 2.4.2.22
History
Date of creation : 2010-11-30
Date of modification : 2013-12-11
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : XMP salvage; magnesium ion binding; plasma membrane; purine ribonucleoside salvage; xanthine phosphoribosyltransferase activity
GO identifier : GO:0032265; GO:0000287; GO:0005886; GO:0006166; GO:0000310
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Glycosyltransferase; Magnesium; Membrane; Metal-binding; Purine salvage; Transferase
General annotation
Pathway : Purine metabolism; XMP biosynthesis via salvage pathway; XMP from xanthine: step 1/1.
Sequence similarities : Belongs to Purine/pyrimidine phosphoribosyltransferase family, XGPT subfamily
Subcellular location : Cell inner membrane; Peripheral membrane protein.
Protein sequence
Length : 167 residues
>E1XAX5|E1XAX5_HAEI1 Haemophilus influenzae 10810
MSEKYVVTWDMFQMHARRLSERLLPASQWKGIIAVSRGGLFPAAVLARELGLRHIETVCI
ASYHDHNNQGELQVLHAAQVPNGGEGFIVVDDLVDTGNTARAIRQMYPNAKFVTVFAKPA
GAELVDDYVIDIPQNTWIEQPWDLGLTFVPPLSRK