HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XAX4

Names and origin
Entry : E1XAX4 (unreviewed)
Entry name : E1XAX4_HAEI1
Protein names : Cell division protein FtsB
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : ftsB
ORF names : HIB_08030
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell division site; cytokinesis by binary fission; integral to plasma membrane
GO identifier : GO:0032153; GO:0043093; GO:0005887
Keywords
Ligand & Biological process : Cell cycle; Cell division; Cell inner membrane; Cell membrane; Coiled coil; Complete proteome; Membrane; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to FtsB family
Subcellular location : Cell inner membrane; Single-pass type II membrane protein.
Protein sequence
Length : 153 residues
>E1XAX4|E1XAX4_HAEI1 Haemophilus influenzae 10810
MFHLSLENNFYTKSAVKIKEFLTALSFILSFFLIFHGKQVKILLTINIRMRLLILILLSV
LVLFQYNFWFGSNGFLDYRQNAEKIKENQAENEKLSQRNQRINAEIQGLTKGFEAIEERA
RMQHGLVKENEVFYHIVKESK