HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XAX1

Names and origin
Entry : E1XAX1 (unreviewed)
Entry name : E1XAX1_HAEI1
Protein names : D-tyrosyl-tRNA(Tyr) deacylase (EC 3.1.-.-)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : dtd
ORF names : HIB_08000
EC number : 3.1.-.-
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : D-amino acid catabolic process; cytoplasm; hydrolase activity, acting on ester bonds
GO identifier : GO:0019478; GO:0005737; GO:0016788
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Hydrolase
General annotation
Sequence similarities : Belongs to DTD family
Subcellular location : Cytoplasm.
Protein sequence
Length : 156 residues
>E1XAX1|E1XAX1_HAEI1 Haemophilus influenzae 10810
MIALIQRVSQAKVDVNGETIGKIGKGLLVLLGVEKEDNREKADKLAEKVLNYRIFSDEND
KMNLNVQQAQGELLIVSQFTLAADTQKGLRPSFSKGASPALANELYEYFIQKCAEKLPVS
TGQFAADMQVNLTNDGPVTFWLNV