HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XAW9

Names and origin
Entry : E1XAW9 (unreviewed)
Entry name : E1XAW9_HAEI1
Protein names : Cell division protein ZapB
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : zapB
ORF names : HIB_07980
History
Date of creation : 2010-11-30
Date of modification : 2013-11-13
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : barrier septum assembly; cytokinesis by binary fission; cytoplasm
GO identifier : GO:0000917; GO:0043093; GO:0005737
Keywords
Ligand & Biological process : Cell cycle; Cell division; Coiled coil; Complete proteome; Cytoplasm; Septation
General annotation
Sequence similarities : Belongs to ZapB family
Subcellular location : Cytoplasm.
Protein sequence
Length : 80 residues
>E1XAW9|E1XAW9_HAEI1 Haemophilus influenzae 10810
MSLEILDQLEEKIKQAVETIQLLQLEVEELKEKNAESQRNIENLQTENEQLKNEHRNWQE
HIRSLLGKFDNV