HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XAW7

Names and origin
Entry : E1XAW7 (unreviewed)
Entry name : E1XAW7_HAEI1
Protein names : Putative HTH-type transcriptional regulator
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_07960
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : sequence-specific DNA binding
GO identifier : GO:0043565
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 110 residues
>E1XAW7|E1XAW7_HAEI1 Haemophilus influenzae 10810
MNNLSAQLENQIDELKKLQKSVITYEQAQRQLLYAGKITDLKAFGKMLNDKRKSLGIELS
MLELQTGVSISTLNRLFQDPSQVRFTTVFLVAQTLGVSLCAI