HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XAS8

Names and origin
Entry : E1XAS8 (unreviewed)
Entry name : E1XAS8_HAEI1
Protein names : Large-conductance mechanosensitive channel
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : mscL
ORF names : HIB_07560
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; ion channel activity; plasma membrane
GO identifier : GO:0016021; GO:0005216; GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Ion channel; Ion transport; Membrane; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to MscL family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Protein sequence
Length : 140 residues
>E1XAS8|E1XAS8_HAEI1 Haemophilus influenzae 10810
MNFIKEFREFAMRGNVVDMAIGVIIGSAFGKIVSSLVSDIFTPVLGILTGGIDFKDMKFV
LAQAQGDVPAVTLNYGLFIQNVIDFIIIAFAIFMMIKVINKVRKPEEKKTAPKAETLLTE
IRDLLKNK