HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XAR2

Names and origin
Entry : E1XAR2 (unreviewed)
Entry name : E1XAR2_HAEI1
Protein names : L-fucose mutarotase (EC 5.1.3.n2) (Fucose 1-epimerase) (Type-2 mutarotase)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : fucU
ORF names : HIB_07400
EC number : 5.1.3.n2
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : L-fucose metabolic process; cytoplasm; fucose binding; racemase and epimerase activity, acting on carbohydrates and derivatives
GO identifier : GO:0042354; GO:0005737; GO:0042806; GO:0016857
Keywords
Ligand & Biological process : Carbohydrate metabolism; Complete proteome; Cytoplasm; Fucose metabolism; Isomerase
General annotation
Pathway : Carbohydrate metabolism; L-fucose metabolism.
Sequence similarities : Belongs to RbsD / FucU family, FucU mutarotase subfamily
Subcellular location : Cytoplasm.
Protein sequence
Length : 156 residues
>E1XAR2|E1XAR2_HAEI1 Haemophilus influenzae 10810
MLKGIHPALSPELLKTLAEMGHGDEIVLADAHFPAHSLHKNVIRADGISIDILLEAITPL
FEFDAYVDAPLLMMKAVEGDSLDPNVETRYLNAIESAVGFTPNLTCLERFDFYTRAKQAY
AVVVSGEIAKYGNIIIKKGVTPIL