HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XAP7

Names and origin
Entry : E1XAP7 (unreviewed)
Entry name : E1XAP7_HAEI1
Protein names : Putative fluoride ion transporter CrcB
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : crcB
ORF names : HIB_07250
History
Date of creation : 2010-11-30
Date of modification : 2013-11-13
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : inorganic anion transmembrane transporter activity; inorganic anion transport; integral to plasma membrane
GO identifier : GO:0015103; GO:0015698; GO:0005887
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to CrcB (TC 9.B.71) family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Protein sequence
Length : 140 residues
>E1XAP7|E1XAP7_HAEI1 Haemophilus influenzae 10810
MQALLFISCGAILGASLRWAIGLLFNPLFSSFAFGTLIANLLGCLIIGVLLGLFWQFPQI
SSEWRLFLITGFLGSLTTFSSFSSEVVELFFNDKWLNGFCVLMMHLFGCLAMTVLGIWIY
KICSQLLS