HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XAP1

Names and origin
Entry : E1XAP1 (unreviewed)
Entry name : E1XAP1_HAEI1
Protein names : Fragment of ornithine carbamoyltransferase
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_07180
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : amino acid binding; carboxyl- or carbamoyltransferase activity; cellular amino acid metabolic process
GO identifier : GO:0016597; GO:0016743; GO:0006520
Keywords
Ligand & Biological process : Complete proteome; Transferase
Protein sequence
Length : 69 residues
>E1XAP1|E1XAP1_HAEI1 Haemophilus influenzae 10810
MMRTLCRVGFSPPKYLTIVCWWAKAHPTTTEDVFESPMNIAFEQAENRMHTIKAVMVASL
A