HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XAM6

Names and origin
Entry : E1XAM6 (unreviewed)
Entry name : E1XAM6_HAEI1
Protein names : Uncharacterized conserved protein involved in oxidation of intracellular sulfur
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_07030
History
Date of creation : 2010-11-30
Date of modification : 2013-05-29
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : cytoplasm; tRNA wobble position uridine thiolation
GO identifier : GO:0005737; GO:0002143
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 103 residues
>E1XAM6|E1XAM6_HAEI1 Haemophilus influenzae 10810
MLYTFSQSDYPKTELDDYFSYITEKDAVVLWQDGVLLAIKYPDYFAKCKGNCMILKQDIL
ARNLTALLPQSSKIKLISIEELVGITENYLPQLSL