HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XAM1

Names and origin
Entry : E1XAM1 (unreviewed)
Entry name : E1XAM1_HAEI1
Protein names : Protein SlyX homolog
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : slyX
ORF names : HIB_06980
History
Date of creation : 2010-11-30
Date of modification : 2013-05-29
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to SlyX family
Protein sequence
Length : 81 residues
>E1XAM1|E1XAM1_HAEI1 Haemophilus influenzae 10810
MQIQQMLENRIEELEMKIAFQEQLLDELNHALVQQQFDIDKMQVQLRYMANKLKDFQPSN
IASQSEETPPPHY