HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XAJ6

Names and origin
Entry : E1XAJ6 (unreviewed)
Entry name : E1XAJ6_HAEI1
Protein names : Translation initiation factor IF-1
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : infA
ORF names : HIB_06720
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; translation initiation factor activity
GO identifier : GO:0005737; GO:0003743
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Initiation factor; Protein biosynthesis
General annotation
Domains : S1-like domain (1)
Sequence similarities : Belongs to IF-1 family
Subcellular location : Cytoplasm.
Protein sequence
Length : 80 residues
>E1XAJ6|E1XAJ6_HAEI1 Haemophilus influenzae 10810
MAKEDCIEMQGTILETLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPY
DLSKGRIIFRSR