HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XAJ4

Names and origin
Entry : E1XAJ4 (unreviewed)
Entry name : E1XAJ4_HAEI1
Protein names : Primosomal replication protein n
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : priB
ORF names : HIB_06700
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA replication, synthesis of RNA primer; primosome complex; single-stranded DNA binding
GO identifier : GO:0006269; GO:1990077; GO:0003697
Keywords
Ligand & Biological process : Complete proteome; DNA replication; DNA-binding; Primosome
General annotation
Domains : SSB domain (1)
Sequence similarities : Belongs to PriB family
Protein sequence
Length : 111 residues
>E1XAJ4|E1XAJ4_HAEI1 Haemophilus influenzae 10810
MKIDNRFSVMGVVSQLPKRLKSPSGIEHCKFLLEHRSDQIESGFTRQAWLKMPVQISGNQ
LIEKTQSITVGSKILVVGFITSHKTQSGLCQLVLHAEQIEFID