HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XAJ0

Names and origin
Entry : E1XAJ0 (unreviewed)
Entry name : E1XAJ0_HAEI1
Protein names : 10 kDa chaperonin (GroES protein) (Protein Cpn10)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : groES
ORF names : groS
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; cytoplasm; protein folding
GO identifier : GO:0005524; GO:0005737; GO:0006457
Keywords
Ligand & Biological process : Chaperone; Complete proteome; Cytoplasm
General annotation
Sequence similarities : Belongs to GroES chaperonin family
Subcellular location : Cytoplasm.
Protein sequence
Length : 104 residues
>E1XAJ0|E1XAJ0_HAEI1 Haemophilus influenzae 10810
MNIRPLHDRVIIKREEVETRSAGGIVLTGSAATKSTRAKVLAVGKGRILENGTVQPLDVK
VGDIVIFNDGYGVKSEKIDGEEVLIISENDILAIVE