HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XAI9

Names and origin
Entry : E1XAI9 (unreviewed)
Entry name : E1XAI9_HAEI1
Protein names : Urease subunit gamma (EC 3.5.1.5) (Urea amidohydrolase subunit gamma)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : ureA
ORF names : HIB_06650
EC number : 3.5.1.5
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; nickel cation binding; urea catabolic process; urease activity
GO identifier : GO:0005737; GO:0016151; GO:0043419; GO:0009039
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Hydrolase
General annotation
Pathway : Nitrogen metabolism; urea degradation; CO(2) and NH(3) from urea (urease route): step 1/1.
Sequence similarities : Belongs to Urease gamma subunit family
Subcellular location : Cytoplasm.
Protein sequence
Length : 108 residues
>E1XAI9|E1XAI9_HAEI1 Haemophilus influenzae 10810
MHLTSREQEKLMLFLAGELAAKRKARGLKLNYPETIAYIASHLQEAARDGMSVAEVMQYG
STLLTVDDVMEGVAEMVHEVQIEATFPDGTKLVTVHNPIR