HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XAI8

Names and origin
Entry : E1XAI8 (unreviewed)
Entry name : E1XAI8_HAEI1
Protein names : Urease subunit beta (EC 3.5.1.5) (Urea amidohydrolase subunit beta)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : ureB
ORF names : HIB_06640
EC number : 3.5.1.5
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; urea catabolic process; urease activity
GO identifier : GO:0005737; GO:0043419; GO:0009039
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Hydrolase
General annotation
Pathway : Nitrogen metabolism; urea degradation; CO(2) and NH(3) from urea (urease route): step 1/1.
Sequence similarities : Belongs to Urease beta subunit family
Subcellular location : Cytoplasm.
Protein sequence
Length : 109 residues
>E1XAI8|E1XAI8_HAEI1 Haemophilus influenzae 10810
MIPGEYQLAEGDILANVGRKTVKIEVTNSGGRPIQVGSHYHFFETNNALKFNRTLARGMR
LNVPSGNAVRFEPGEVKSVELVAFGGNQIIYGFHNQIDGKL