HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XAH5

Names and origin
Entry : E1XAH5 (unreviewed)
Entry name : E1XAH5_HAEI1
Protein names : Predicted 4Fe-4S cluster-containing protein
Organism : Haemophilus influenzae 10810
Organism ID : 862964
ORF names : HIB_06510
History
Date of creation : 2010-11-30
Date of modification : 2013-05-29
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : iron-sulfur cluster binding
GO identifier : GO:0051536
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 94 residues
>E1XAH5|E1XAH5_HAEI1 Haemophilus influenzae 10810
MALLITSKCTNCDMCLPECPNEAISIGDEIYVIDPILCTECVGHYDTPTCQKVCPITNCI
KPDPEHQETEEQLWERFVMIHHSDKL