HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XAF8

Names and origin
Entry : E1XAF8 (unreviewed)
Entry name : E1XAF8_HAEI1
Protein names : Regulator of ribonuclease activity A
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : rraA
ORF names : HIB_06340
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; regulation of RNA metabolic process; ribonuclease inhibitor activity
GO identifier : GO:0005737; GO:0051252; GO:0008428
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm
General annotation
Sequence similarities : Belongs to RraA family
Subcellular location : Cytoplasm.
Protein sequence
Length : 174 residues
>E1XAF8|E1XAF8_HAEI1 Haemophilus influenzae 10810
MFIDTSELCDLYAEQVDVVEPIFSSFGGVSHFYGKVTTVKCFESNGLIAEVLEENGEGRV
LVIDGGGAVRRGLIDAELAQLAVDNGWEGIIVYGAVRQIQQLENLDIGIHALAPIPVSAD
ESSAGESDIPVNFGGVTFFPEDYIYADLTGIILSQEPLDLED