HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E1XAD8

Names and origin
Entry : E1XAD8 (unreviewed)
Entry name : E1XAD8_HAEI1
Protein names : ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6)
Organism : Haemophilus influenzae 10810
Organism ID : 862964
Gene names : atpB
ORF names : HIB_06140
History
Date of creation : 2010-11-30
Date of modification : 2013-10-16
Date of sequence modification : 2010-11-30
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; plasma membrane; plasma membrane ATP synthesis coupled proton transport; proton-transporting ATP synthase activity, rotational mechanism; proton-transporting ATP synthase complex, coupling factor F(o)
GO identifier : GO:0016021; GO:0005886; GO:0042777; GO:0046933; GO:0045263
Keywords
Ligand & Biological process : ATP synthesis; CF(0); Cell inner membrane; Cell membrane; Complete proteome; Hydrogen ion transport; Ion transport; Membrane; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to ATPase A chain family
Subcellular location : Cell inner membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein.
Protein sequence
Length : 282 residues
>E1XAD8|E1XAD8_HAEI1 Haemophilus influenzae 10810
MSGQTTSEYISHHLSFLKTGDGFWNVHIDTLFFSILAAVIFLFVFSRVGKKATTGVPGKM
QCLVEIVVEWVNGIVKENFHGPRNVVAPLALTIFCWVFIMNAIDLIPVDFLPQFAGLFGI
HYLRAVPTADISATLGMSICVFFLILFYTIKSKGFKGLVKEYTLHPFNHWAFIPVNFILE
TVTLLAKPISLAFRLFGNMYAGELIFILIAVMYSANMAIAALGIPLHLAWAIFHILVITL
QAFIFMMLTVVYLSIAYNKADH